Korean Society for Biotechnology and Bioengineering Journal Korean Society for Biotechnology and Bioengineering Journal

pISSN 1225-7117 eISSN 2288-8268
qr-code Download

Article

Home All Articles View

Review Paper

Korean Society for Biotechnology and Bioengineering Journal 2022; 37(3): 83-92

Published online September 30, 2022 https://doi.org/10.7841/ksbbj.2022.37.3.83

Copyright © Korean Society for Biotechnology and Bioengineering.

병원성 박테리아 검출이 가능한 항균 펩타이드 기반 바이오센서의 최신 동향

Recent Advances in Pathogenic Bacteria Detection with Antimicrobial Peptide as Recognition Element

Jung Eun Kim, and Jong Pil Park*

Department of Food Science and Technology, Chung-Ang University, Anseong 17546, Korea

Correspondence to:Tel: +82-31-670-4703, Fax: +82-31-675-1381
E-mail: jppark@cau.ac.kr

Received: August 14, 2022; Revised: September 26, 2022; Accepted: September 26, 2022

Abstract

Go to

Detection of pathogenic bacteria using antimicrobial peptides can be an alternative way over traditional detection method. Due to its high stability and low cost, it has been studied as a bio-recognition of biosensors. Antimicrobial peptides can be produced naturally to protect host cells from pathogenic bacteria or chemically synthesized in the laboratory with well-known methods. Antibacterial peptides can interact electrostatically with the membrane of pathogenic bacteria, an anionic molecule, and become a source of bacterial detection using electrochemical and optical biosensors. In this review, overall characteristics of antibacterial peptides and its use in biosensor development were summarized.

Keywords: antimicrobial peptide, bacteria detection, electrochemical biosensor, optical biosensor

1. INTRODUCTION

Go to

숙주 방어 펩타이드 (host defense peptide)라고 알려진 항균펩타이드 (antimicrobial peptide, AMP)는 병원성 박테리아(pathogen bacteria)의 침입으로부터 숙주를 보호하기 위한 첫 번째 방어선으로 작용되며, 박테리아, 바이러스, 곰팡이, 식물 및 동물 등 대부분의 생명체에서 발견되는 선천적 면역반응의 필수적인 부분이라 알려져 있다 [1,2]. 또한, 다양한 항균, 항바이러스, 항진균 및 항암 활성을 나타내며, 내성을 유발할 수 있는 항생제 대체 물질로써 항균 펩타이드에 대한 연구는 지속적으로 관심을 받고 있는 실정이다 [3]. 대표적인 적용 예로서는 산업적으로 사용되고 있는 식품 방부제, 살충제 및 암 치료제 등이 있다 [4].

항균 펩타이드는 병원성 박테리아에 대한 선택성이 뛰어나며, 하나의 생체 인식 요소 (bio-recognition)로 작용하여 병원성 박테리아를 검출할 수 있을 것으로 기대되고 있다 [3]. 병원성 박테리아의 감염은 심각한 경제적, 사회적 영향을 미치는 위협적인 공중 보건 문제 중 하나이며, 이를 검출하기 위해 사용된 가장 일반적인 방법으로는 집락 형성 단위(colony forming unit, CFU) 측정 [5], 효소면역분석 (enzymelinked immunosorbent assay, ELISA) [6], 중합효소 연쇄 반응(polymerase chain reaction, PCR) [7]을 통한 분석 등이 있다. 이러한 분석은 검출 시간이 오래 걸리며 [8], 환경에 영향을 많이 받아 불안정할 수 있으며, 비용이 많이 들고 분석 전 시료 농축 및 정제 단계를 거쳐야 한다는 한계가 있다 [9]. 따라서, 보다 신속하고 민감하면서 동시에 비용을 줄일 수 있는 방법으로 병원성 박테리아를 검출할 수 있는 항균 펩타이드 기반 바이오 센서는 많은 장점을 지니고 있다 [10].

바이오센서는, 일반적으로 표적 (target) 물질과 상호작용하는 생체 인식 요소와 이를 측정 가능한 신호로 변환(transduction platform) 시켜주는 신호 변환 요소로 구성되어 표적 물질을 검출하는 장치를 말한다. 대표적 생체 인식 요소로서는 표적 물질과 높은 특이성을 가지고 있는 항체, 효소, 항균 펩타이드로 알려져 있고 [4], 이에 대한 장단점을 정리하였다 (Table 1). 항균 펩타이드 기반 바이오센서는 생체인식 요소를 항균 펩타이드를 사용한 것으로, 이는 생물 공학적 방법, 화학적 방법을 통해 합성된다. 또한, 항체 기반 검출 센서보다 비용적 측면, 안정성에 있어 우수한 것으로 보고되고 있으며 [11], 환경오염, 박테리아로 인한 식중독, 의약품 테스트와 같은 다양한 영역에 영향을 미칠 수 있다는 점에서 주목받고 있다 [12]. 이에 본 연구에서는 항균 펩타이드의 전반적인 특성에 대해 소개하고, 항균 펩타이드를 기반으로 한 다양한 병원성 박테리아를 전기화학적 방법, 광학적 방법을 이용하여 검출하는 방법에 대해 살펴보고자 한다.

Table 1 Comparison of bio-recognition elements for detection of pathogenic bacteria

Bio-recognition elementAdvantagesLimitationsRef
AntibodyHighly specific for antigenExpensive and several steps for detection[62], [63]
Direct recognition without cell damageLower stability in acidic and alkaline pH and high temperature
EnzymeHighly stable in wide pH rangeMultiple steps of analysis required[64], [65]
Strongly binding for targetRelatively lower long-term stability
Short lifetime and low reproducibility
Antimicrobial peptideHigh reliability and low costRelatively low specificity[10], [65]
Multiple detectionCell damage

2. Antimicrobial Peptides (AMPs)

Go to

2.1. Origin of AMPs

항균 펩타이드는 1939년 Dubos가 Bacillus brevis에서 항균제를 처음으로 발견하였고 [13], Hotchkiss와 Dubos는 추출물을 분류하여 Gramicidin이라는 항균 펩타이드를 최초로 발견하여 보고하였다 [14]. 1962년 Kiss and Michl은 Bombina variegata의 피부 분비물에서 항균 및 용혈성 펩타이드의 존재를 밝혔으며, 이로 인해 Bombinin이라는 항균 펩타이드가 분리되었다 [15]. 뿐만 아니라 항균 펩타이드는 다양한 박테리아, 곰팡이, 식물, 양서류, 곤충, 포유류, 바이러스에서도 발견되고 있고, 현재 3300개 이상의 항균 펩타이드가 밝혀져 있다 [16,17].

항균 펩타이드는 일반적으로 2-50개의 아미노산으로 구성되어 있으며, 리신 (lysine), 아르기닌 (arginine) 잔기로 인해양전하 (+2 ~ +11)를 띠며 소수성 아미노산 잔기가 풍부하다는 특징을 갖는다 [18]. 이러한 항균 펩타이드는 양이온 전하와 소수성 성분을 모두 갖고 있기 때문에 양친매성을 띠며, 이는 음이온성 박테리아 세포막 또는 기타 음이온성 표적에 정전기적으로 결합할 수 있다고 보고되어 왔다 [19]. 항균 펩타이드는 2차 구조에 따라 α 나선구조 (α-helix), β 병풍구조(β-sheet) 또는 긴 불규칙 나사선 구조로 분류된다 [20]. 현재까지 알려진 연구에 의하면, 항균 펩타이드와 박테리아 사이의 메커니즘은 막 표적과 세포 내 표적으로 나뉘어 연구되고 있으며, 다음과 같이 정리할 수 있다. 양이온성 항균 펩타이드가 세포막에서 응집할 때 항균 펩타이드의 소수성 영역은 인지질 이중층의 지질영역과 상호작용하고, 이후 지질 이중층에 삽입되어 기공 형성, 막 용해 (membrane lysis), 세포질누출 (cytoplasmic leakage), 세포 사멸을 유발한다 [21]. 이는 항균 펩타이드가 박테리아 막을 표적으로 파괴하는 것이며, 현재까지 Barrel-stave model, Carpet model, Toroidal-pore model또는 Detergent-like model의 메커니즘이 제안돼 왔다 [22].또한, 세포벽 합성에 영향을 미치거나, 핵산 합성을 억제하고, 단백질 접힘 과정에 영향을 미치는 것과 같은 세포 내 표적에 의해 박테리아를 사멸할 수 있다는 사실도 밝혀졌다[17].

2.2. Synthesis of AMPs via Biological Engineering Approaches

2.2.1. AMP Derived from Bacteria

박테리아에 의해 생산된 항균 펩타이드는 최초로 연구된 항균 펩타이드 (bacteriocin)이며, bacteriocin은 각 균주에 특성화된 면역 작용을 가지고 있어 숙주 박테리아가 아닌 다른 박테리아에 대해서만 항균 활성을 보인다 [23]. 외부 미생물로부터 박테리아 자신을 보호할 수 있는 면역 작용이라 볼 수 있는 것이다. 박테리아에 의해 합성되는 항균 펩타이드는 크게 두 방법으로 나눠지는데, 첫 번째는 mRNA의 리보솜(ribosome)을 통한 번역과정, 두 번째는 비 리보솜 (non-ribosome)에 의해 합성되는 것이다 [16].

첫 번째 방법을 이용한 항균 펩타이드 합성은 박테리아 뿐만 아니라 다른 살아있는 유기체에서도 나타나며, 두 번째방법을 이용한 항균 펩타이드 합성은 매우 변형된 아미노산으로 구성되어 있으며 박테리아에서만 나타난다 [24]. 또한bacteriocin이 리보솜에서 합성된다 하더라도 번역 후 변형(post-translational modification, PTM) 될 수 있으며, 광범위한 아미노산 서열, 구조로 인해 다양한 분류 체계가 제시된다 [25]. 대표적으로 그람 양성 박테리아로부터 분리된bacteriocin은 Class I, Class II로 분류되며, Class I은 PTM을가진 항균 펩타이드를 포함하며, Class II는 변형되지 않은bacteriocin을 포함한다. 그람 음성 박테리아로부터 분리된bacteriocin은 일반적으로 Microcins으로 알려져 있으며, 이는 대장균 (E. coli)의 리보솜을 통해 합성된다 [26]. 재조합된 항균 펩타이드는 주로 대장균과 고초균 (B. subtilis)에 의해 발현되며, 대장균의 경우 발효량이 적고 빠르게 성장하며, 사용이 간편하다는 점에서 선호되고 있다 [27].

하지만 대장균에서의 항균 펩타이드 생산은 내 독소(endotoxin), 지질 다당류 (lipopolysaccharide)로 인한 오염이 발생할 수 있어, 내 독소를 생성하지 않는 고초균을 통한 항균 펩타이드 생산이 이뤄지기도 한다 [28]. 뿐만 아니라 다른 박테리아에서도 항균 펩타이드를 생산할 수 있으며 그의 대표적인 예를 정리하였다 (Table 2).

Table 2 Characteristics of antimicrobial peptide derived from bacteria, plant and insect

OrganismAMPSequenceAntimicrobial activityRef
G+G-
B. brevis1Gramicidin ACHOVGADLADVVDVWDLWDLWLW NHCH2CH2OH++[66]
B. subtilis1Gageotetrin ALE-C14H27O3++[67]
E. coli1Microcin J25VGIGTPIFSYGGGAGHVPEYF+[68]
E. coli1Microcin B17VGIGGGGGGGGGGSCGGQGGGCGGCSNGCSGGNGGSGGSGSHI+[69]
L. lactis1Nisin AIDhbcyclo(AIDhaLA)cyclo(AbuPGA)Kcyclo(AbuGALMGA)NMKcyclo(AbuAAbuAHA)SIHVDhaK++[70]
C. parviflora2Circulin AGIPCGESCVWIPCISAALGCSCKNKVCYRN+[71]
Circulin BVIPCGESCVFIPCISTLLGCSCKNKVCYRN++[71]
C. ternatea2Ct-AMP1NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC+[72]
D. merckii2Dm-AMP1ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC+[72]
P. longipes2CyclopsychotrideASIPCGESCVFIPCTVTALLGCSCKSKVCYKN++[71]
H. cecropia3Cecropin AKWKLFKKIEKVGQRVDAVISAGPAVATVAQAATALAK+[41]
S. calcitrans3StomoxynRGFRKHFNKLVKKVKHTISETAHVAKDTAVIAG+[45]
P. maculiventris3ThanatinGSKKPVPIIYCNRRAATGKCQRM++[73]
P. apterus3DefensinATCDILSFQSQWVTPNHAGCALHCVIKGYKGGQCKITVCHCRR+[74]
A. cerana cerana3ApidaecinGNNRPIYIPQPRPPHPRL+[43]
R. prolixus3AttacinSPRPDDKKNQGSASVDVQNERGEGTKVDARVRQELWRSDDGRTRAQAYGHWDRTYGGRNHGERSYGGGMRIEHTWGN+[75]

1bacteria; 2plant; 3insect; G+ : Gram positive bacteria; G- : Gram negative bacteria; Dhb : didehydroaminobutyric acid; Abu : animobutidic acid; Dha : dehydroalanine

2.2.2 AMPs Derived from Plant

식물은 곰팡이 및 박테리아로부터 자신을 보호하기 위해 항균 펩타이드를 다량 생산하며, 잎, 뿌리, 씨앗, 꽃, 줄기와 같은 식물의 모든 부분에서 항균 펩타이드를 얻을 수 있다 [29].식물 기반 항균 펩타이드는 다양한 구조와 기능, 작용 메커니즘을 가지고 있어 분류가 어려우나, 아미노산의 유사한 서열 및 삼차원 구조로 인해 Thionins, Defensins, Hevein-like peptides, Knottins, Stable-like peptides, Lipid transfer proteins, Snakins, Cyclotides로 나눠진다 [18]. 다양한 분류 중, Thionins와 Defensins이 가장 많이 연구되어 왔고, 이 두 분류에 대해 자세히 소개하고자 한다. Thionins은 식물로부터 분리된 최초의 항균 펩타이드이며 [30], 고농도의 아르기닌, 라이신(lysine), 시스테인 (cysteine)을 포함하는 45-48개의 아미노산잔기(약 5kDa)로 구성된다 [31]. 이는 α/β-Thionins와 λ-Thionins두 그룹으로 나뉘며, α/β-Thionins은 아미노산의 유사한 서열,이황화 결합 위치에 따라 다시 5가지 유형 (I-V)으로 분류된다 [32]. 유형 I Thionins은 45개의 아미노산 서열로 이루어져 있으며, 그중 8개는 시스테인이다. 또한 염기성 아미노산의 함량이 높고 대표적으로 Poaceae의 종자에서 발견된다. 유형 II Thionins은 46-47개의 아미노산 서열로 이루어져 있으며, 유형 I Thionins와 동일하게 8개의 시스테인 잔기가 포함된다. 또한, I Thionins에 비해 염기성 아미노산 함량이 낮고대표적으로 Pyrularia pubera의 잎과 견과에서 발견된다. 유형 III Thionins은 45-46개의 아미노산 서열로 이루어져 있으며, 3개의 이황화 결합을 가지고 있다. 또한 II Thionins와 유사한 전하를 가지고 있고, 대표적으로 Viscum album의 줄기와 잎에서 발견된다. 유형 IV Thionins은 46개의 아미노산 서열로 이루어져 있으며, 3개의 이황화 결합을 가지고 있다. 또한 펩타이드 자체가 중성을 띠며, 대표적으로 Crambe abyssinica의 종자에서 발견된다. 유형 V Thionins은 밀 종자에서 얻은I Thionins에서 파생된 것으로, 대표적으로 Helleborus purpurascens의 뿌리에서 발견된다. λ-Thionins의 경우에는Defensins와 많은 유사성을 가지고 있어 Defensins로 분류되기도 한다 [33,34]. Defensins는 식물 병원균에 대한 방어체계의 주요 구성 요소이며, 시스테인이 풍부한 45-54개의 아미노산 (약 5kDa) 잔기로 구성된다. 이는 양전하를 띠고 있으며, 4개의 이황화 결합으로 인해 열과 pH에 안정적이다 [35]. 또한, 매우 낮은 농도에서 박테리아와 곰팡이에 대한 항균활성을 나타내며, Dahlia merckii 및 Heuchera sanguine과 같은 식물의 잎, 뿌리, 줄기 및 열매에서 발견된다 [36].

2.2.3 AMPs Derived from Insect

곤충은 종 다양성 측면에서 동물계 내에서 가장 큰 부류로 대표하며, 미생물 감염으로부터 자신을 보호하기 위해 끊임없이 진화하여 강력한 방어 메커니즘을 발달시켰다 [37]. 곤충의 항균 펩타이드는 포유류의 간과 같은 곤충의 지방체(fat body)에서 합성되며, 혈액세포 (hemolymph)를 통해 분비된다 [38]. 곤충 유래 항균 펩타이드는 양이온성 및 양친매성을 특징으로 하며, 대부분은 비교적 낮은 분자량 (≥10 kDa)을 갖는다 [39]. 또한, 아미노산의 길이, 서열 및 구조적특성에 의해 세 종류로 분류된다. 첫 번째 유형은 시스테인잔기 없는 양친매성 α 나선의 선형 펩타이드로, 29-42개의아미노산 서열로 이루어져 있다. 이들은 그람 양성 박테리아보다 그람 음성 박테리아에 대해 더 큰 항균 활성을 나타내며, 대표적인 예로 1980년 H. cecropia의 번데기로부터 분리된 최초의 곤충 항균 펩타이드인 Cecropin과, 이와 유사한Stomoxyn, Enbacin, Spodopsin 등이 있다 [40-42].

두 번째 유형은 시스테인 잔기를 포함하고 분자 내 이황화결합을 형성하는 펩타이드로, hairpin과 같은 β 시트 또는 α나선, β 시트의 혼합 구조를 형성한다. 대표적인 예로 Podisus maculiventris에서 발현된 Thanatin, Pyrrhocoris apterus에서 발현된 Defensin이 있다 [37]. Thanatin의 경우 그람 양성, 음성 박테리아에 대해 모두 항균 활성을 나타내며 Defensin의경우 그람 음성 박테리아보다 그람 양성 박테리아에 대해 더큰 항균 활성을 나타낸다. 세 번째 유형은 프롤린 (proline),글리신 (glycine)이 풍부한 펩타이드이다. 프롤린이 풍부한 경우에는 14-39개의 아미노산 서열로 이루어져 있으며, 짧은 서열을 가지고 있는 경우 그람 양성 박테리아보다 그람음성 박테리아에 대해 더 높은 항균 활성을 나타낸다. 대표적으로 Apis cerana cerana에서 발현된 Apidaecin이 있다[43]. 글리신이 풍부한 경우에는 다양한 아미노산 서열과 분자량을 가지며, 대표적으로 Rhodnius prolixus에서 발현된Attacin이 있다 [44]. 이는 그람 음성 박테리아에 대해서 항균활성을 나타낸다 [45].

2.3. Synthetic AMPs via Chemical Approaches

실험실에서의 항균 펩타이드 합성은 화학적 합성 (chemical synthesis), 효소적 합성 (enzymatic synthesis) 및 생합성(biosynthesis)의 세 가지 주요 방법이 사용되며, 이 중 화학적합성이 가장 많이 사용되고 있다 [28]. 화학적 합성의 경우두 개 이상의 아미노산이 펩타이드 결합 (peptide bond)을 통해 연결되는 간단한 화학 반응이 수반되며, 이는 다음과 같이 정리할 수 있다. 우선 한 아미노산의 카복실기 (carboxyl group)가 활성화제와 반응하여 아실 (acyl) 기능기를 제공할 수 있도록 활성화되어야 한다. 이후 다른 아미노산의 아미노기 즉 아실 수용체 (acyl receptor)에 의해 활성화된 카복실기는 친핵성 공격을 받게 되고, 제조된 이합체는 커플링제(cupling agent)와 반응하여 펩타이드 결합을 형성하게 된다.펩타이드의 화학적 합성은 카복실기 활성화제 및 커플링제의 도움을 받아 이루어지며, 펩타이드를 합성하기 이전에 펩타이드 결합에 직접적으로 작용하지 않는 다른 모든 작용기는 보호되거나 차단되어야 한다. 이러한 펩타이드 결합을 이용하여 항균 펩타이드는 고체상에서의 펩타이드 합성 (solid-phase peptide synthesis, SPPS), 액체상에서의 펩타이드 합성(solution-phase peptide synthesis, SPS)으로 나누어진다 [46].액체상에서의 펩타이드 합성 방법으로는 아실 수용체의 α카복실기를 에스터화 (esterification) 또는 아미노화 (amination)하여 다음 아미노산을 펩타이드 결합을 통해 연결하는 방법이 있다.

고체상에서의 펩타이드 합성 방법으로는 먼저, 하나의 아미노산 (Amino acid)은 펩타이드 합성 전반 과정에 있어 카복실기 (carboxyl group)의 보호제 (지지체)인 레진 (resin)과 공유결합하여 연결되고, 연결된 아미노산의 α 아미노기는분리 절차를 걸쳐 미리 처리된 보호제를 제거하는 과정을 거친다. 이후 두 번째 아미노산을 펩타이드 결합을 통해 첫 번째 아미노산에 연결해 주고, 원하는 펩타이드 서열이 형성될 때까지 앞에 과정을 반복하여 최종 펩타이드를 합성해 준다. 합성이 완료되었다면, 레진을 세척하여 레진으로부터 아미노산을 분리시켜 침전, 농축, 건조 과정을 거치게 되는 것이다. 이 합성 방법은 항상 C-말단부터 N-말단의 순서로 진행되며, 펩타이드 합성 방법 중 가장 일반적으로 많이 사용되고 있다. 또한, 액체 상태에서 합성된 펩타이드보다 더 복잡하고 긴 펩타이드 (30-50개 잔기)를 빠르게 합성할 수 있다는 점에서 펩타이드 합성 시 선호되고 있다 [24].

3. Development of AMPs-Based Biosensor

Go to

3.1. AMP as Bio-receptor for Detection of Pathogenic Bacteria

항균 펩타이드와 표적 박테리아 사이의 상호작용은 작용 메커니즘과 상관없이 양친매성을 띤 펩타이드와 음전하를 띤 세포막 (lipopolysaccharide) 및 기타 음이온성 표적의 정전기적 인력과 관계 있다 [47]. 이는 항균 펩타이드를 하나의 생체 인식 요소로 사용하여 표적 물질을 식별하여 병원성 박테리아를 검출할 수 있음을 시사하고 있다. 생체 인식 요소는 표적 물질을 식별하는데 있어 민감성과 특이성을 가져 바이오센서의 효율을 결정하는데 중요한 요소로 작용된다. 효소와 항체는 자연에서 유래된 생체 인식 요소의 두 가지 대표적 예로, 효소 바이오센서의 경우 효소와 기질의 상호작용, 면역 바이오센서 (항체로 코팅)의 경우 미생물 표면에 존재하는 항원과의 상호작용으로 인해 표적 물질을 식별할 수 있다고 알려져 있다 [48]. 두 가지 모두 높은 수준의 특이성을 가지고 있으나, 보관 및 안정성 측면에서 한계가 있고, 각각의 바이오센서에 대한 특정 문제도 존재한다 [4]. 생체 인식 요소로써의 항균 펩타이드 사용은 효소, 항체에 비해 주변환경에 더욱 안정적이며 [49], 고체상에서의 펩타이드 합성으로 인해 저렴한 비용으로 대량 합성이 가능하다는 것이 특징이다 [50]. 또한, 항균 펩타이드는 작은 분자 크기를 가져, 센서 표면에 높은 밀도로 고정화될 수 있다는 장점이 있다(Fig. 1).

Figure 1. Illustration of AMP-based biosensor for pathogenic bacteria detection.

3.2. AMP-Based Electrochemical Biosensors

병원성 박테리아를 검출하기 위해 사용되는 바이오센서 중 가장 많이 연구되고 있는 것은 전기화학적 바이오센서이다. 전기화학적 바이오센서란 전류 (current) 및 임피던스 (impedance)변화를 통해 생물학적 인식 신호를 측정 가능한 신호로 바꾸어 표적 물질을 검출 및 정량하는 기술을 말한다. 일반적으로 항균 펩타이드는 박테리아를 포획하기 위해 바이오센서기판 표면에 고정되어야 하며, 항균 펩타이드의 고정은 병원성 박테리아와 정전기적 및 소수성 상호작용을 통해서 전기적인 신호 변화를 발생한다. 이러한 전기화학적 바이오센서는 다른 바이오센서에 비해 비용이 저렴하고 다루기 쉽다는 점에서 많이 연구되고 있으며, 그에 대한 연구 결과들이 다양하게 보고되고 있다 [51].

Kulagina 등은 항균 펩타이드 (Synoeca-MP)로 코팅된 자성 나노입자를 이용하여 그람 음성 박테리아를 검출하였다 [52]. Synoeca-MP는 세포독성과 막 파괴를 촉진하는 항균 펩타이드로, 해당 연구에서는 키토산으로 코팅된 자성 나노입자(Fe3O4-Chit) 위에 고정되어 생체 인식요소로 작용하였다. 바이오센서의 금 기판은 4-메르캅토벤조산 (mercaptobenzoic acid, MBA)을 이용하여 자가조립 단분자층 (self-assembled monolayer, SAM)을 형성하며, EDC/NHS 커플링 [53]을 통해 Fe3O4-Chit와 결합시켜 최종적으로 AMP@Fe3O4-Chit@MBA @Au를 형성했다. 해당 연구에서는 cyclic voltammetry (CV), electrochemical impedance spectroscopy (EIS)를 이용한 E. faecalis (G+), K. pneumoniae (G-), P. aeruginosa (G-), C. tropicalis의 검출이 진행되었고, 그 중 그람 음성 박테리아인 K. pneumoniae에 대해 높은 민감도를 보였다.

Andrade 등은 탄소 나노튜브 (carbon nanotube, CNT)와 항균 펩타이드 (Clavanin A)를 기반으로 하여 박테리아를 검출하였다 [2]. Clavanin A는 해양 피낭동물 (tunicate) Styela clava의 혈구에서 처음 분리된 자연 발생 항균 펩타이드로[54], 해당 연구에서는 CNT에 고정되어 생체 인식요소로 작용하였다. 바이오센서의 금 기판은 cysteine을 이용하여SAM을 형성하며, EDC/NHS 커플링을 통해 CNT와 결합하였다. 결합한 CNT는 또다시 EDC/NHS 커플링을 통해 Clavanin A와 결합하게 되고 최종적으로 AMP@CNT@Au를 형성하였다. 해당 연구에서는 EIS를 이용한 K. pneumoniae (G-), E. faecalis (G+), E. coli (G-), B. subtilis (G+)의 검출이 진행되었고, 항균 펩타이드의 표적 박테리아 포획은 CNT에 의해장애물 신호로 감지되어 신호를 증폭, 변형하였다. 또한, 그람 양성 박테리아와 그람 음성 박테리아에 대한 신호의 차이로 인해 이를 구별할 수 있는 결과를 얻었다.

Li 등은 페로센 (ferrocene, Fc)이 표지된 항균 펩타이드(Magainin I)를 이용하여 E. coli O157:H7을 검출하였다 [55]. Magainin I은 박테리아 세포막에 기공을 만들어 세포 용해를 촉진하는 항균 펩타이드로, 다양한 바이오센서의 생체 인식요소로 사용되고 있다 [56]. 바이오센서의 금 기판은 리포산 NHS (Lipoic acid NHS)를 이용하여 SAM을 형성하여, 산화환원 프로브인 Fc와 결합시킨다. 그 후 EDC/NHS 커플링을 이용하여 Fc에 Magainin I을 고정화하여 AMP@Fc@Lip-NHS@Au를 형성하였다. 해당 연구에서는 EIS를 이용한 E. coli 검출이 진행되었고, 기존 전기화학 바이오센서와 달리 표적 박테리아가 있을 때 더 작은 임피던스 변화가 관찰되었다. 이는 항균 펩타이드와 표적 박테리아의 결합으로 인한 항균 펩타이드의 구조적 변화로 인해 Fc그룹의 전하 이동이 증가하여 임피던스가 감소한 이유이다. 뿐만 아니라 살아있는 박테리아와 죽어있는 박테리아를 구별할 수 있는 바이오센서에 관한 연구도 진행되고 있으며 [5], 항균 펩타이드를 이용한 전기화학적 바이오센서에 대해 정리하였다 (Table 3).

Table 3 AMPs-incorporated electrochemical sensor for bacteria detection

Recognition elementElectrodeDetection methodLimit of detection(LOD)TargetRef
AMP (Synoeca-MP)Fe3O4-Chit on gold surface-MBACV and EIS101 CFU/mLK. pneumoniae; P. aeruginosa; E. faecalis; C. tropicalis[52]
AMP (Temporin-PTA)Fe3O4@Au on gold surface-MBACV and EIS101 CFU/mLK. pneumoniae; A. baumannii; B. subtilis; E. faecalis; C. albicans; C. tropic[61]
AMP (Synthetic AMP - sAMP)Gold-disk electrodeCV and EIS102 CFU/mLE. coli; P. aeruginosa S. aureus; S. epidermidis[5]
AMP (Clavanin A)Cys-Gold nanoparticleEIS101 CFU/mLS. aureus; E. faecalis; P. aeruginosa; S. typhimurium; E. coli[76]
AMP (hLF1-11)Epoxysilane functionalized interdigitated electrode arrayEIS101 CFU/mLS. sanguinis[77]
AMP (Nisin)Chemical linker (EDC/NHS) Crosslinker (Glutaraldehyde)EIS1.5×101 CFU/mLSalmonella spp.[78]
AMP (Magainin I)Ferrocene labelEIS103 CFU/mLE. coli[55]
AMP (Leucocin A)Gold interdigitated array with cysteamineEIS103 CFU/mLL. monocytogenes[79]
AMP (C16G2cts and G10kHc)Gold microfluidic chipEIS105 CFU/mLS. mutans; P. aeruginosa[80]
AMP (Clavanin A)Carbon nanotube (CNT)EIS102 ×106 CFU/mLK. pneumoniae; E. faecalis; E. coli; B. subtilis[2]

AMP : antimicrobial peptide; CV : cyclic voltammetry; EIS : electrochemical impedance spectroscopy

3.3. AMP-Based Optical biosensors

광학 바이오센서는 쉬운 조작, 높은 감도 및 빠른 검출로 인해 전기화학 기반 바이오센서와 함께 많이 연구되어 왔다. 광학 바이오센서란 표적 물질 결합으로 인해 생긴 센서 표면의 광학 특성 변화를 측정 가능한 신호로 바꾸어 표적 물질을 검출 및 정량하는 기술을 말한다. 형광 물질의 유무에 따라 크게 나눠지며, 작게는 굴절, 반사, 흡수 및 분산과 같은 매개변수에 따라 표면 플라스몬 공명 (surface plasmon resonance, SPR), 비색 (colorimetric), 형광 (fluorescent), 표면 증강 라만 분광학 (surface enhanced Raman spectroscopy, SERS), 화학발광 (chemiluminescence )방법으로 나눠진다 [57].

Zhou 등은 은 나노입자 환원 그래핀옥사이드 (AgNPs-rGO)와 항균 펩타이드 (Magainin I)를 기반으로 SPR방법을 통해 E. coli O157:H7을 검출하였다 [56]. SPR 기반 바이오센서는 얇은 금속막에서의 플라스몬 전자 주파수 변화로 인한 광 굴절률의 변화를 모니터링함으로써 표적 물질을 검출할 수 있는 바이오센서이다 [58]. 해당 바이오센서는 신호 증폭에 도움을 주는 AgNPs-rGO를 광섬유 표면에 고정하고 금 막으로 덮은 뒤 Magainin I을 고정하였다. Magainin I은 표적 물질이 존재할 때 이를 포획하여 SPR의 흡수 파장을 생성하며, 해당연구에서는 수돗물, 과일, 야채 주스 등 실제 샘플에서도 E. coli O157:H7을 검출할 수 있는 결과를 보고하였다.

Ha 등은 마이크로비드 (microbead)와 항균 펩타이드 (Magainin I)를 기반으로 한 미세 유체 칩 (microfluidic chip)을 개발하였다 [59]. Thiol-maleimide reaction을 통해 Magainin I은 비드 표면에 고정되었고, 항균 펩타이드가 고정된 비드는 미세 유체 칩에 주입되어 표적 물질이 있을 때 표적 물질과 상호작용하게 되었다. 해당 연구에서는 표적 물질인 E. coli를 형광물질인 프로피듐 아이오다이드 (propidium iodide, PI)로 염색하여 미세 유체 칩에 주입하였고, 이를 형광 현미경(fluorescence microscope)을 통해 검출하였다. E. coli와 항균 펩타이드의 특이적 결합으로 인해 시간이 지날수록, 표적 물질의 농도가 높을수록 형광 강도가 높게 측정되었으며, 이는 형광 기반 E. coli의 신속한 검출의 대표적 예이다. 뿐만 아니라 비색방법을 이용한 박테리아 검출 연구도 진행되고 있으며, 이에 관한 연구 결과들을 정리하였다 (Table 4).

Table 4 AMPs-incorporated optical sensor for bacteria detection

Recognition elementElectrodeDetection methodLimit of detection (LOD)TargetRef
AMP (Magainin I)AuNPs-rGOSPR5.0 × 102 CFU/mLE. coli O157:H7[56]
AMP (Magainin I)MicrobeadFluorescence103 CFU/mLE. coli[59]
AMP (Magainin I)Silanized glass slideFluorescence1.6 × 105; 6.5 × 104 cells/mLE. coli O157:H7; S. typhimurium[81]
AMP (Warnericin RK)GaAs/AlGaAs DIPFluorescence103 CFU/mLL. pneumophila[3]
AMP (Polymyxins)Chemical linker (maleimide) with fluorescent dyeFluorescence5.0 × 104 CFU/mLE. coli O157:H7[82]
AMP (Magainin I)Horseradish peroxidase (HRP)Colorimetric119-451 CFU/mLE. coli O157:H7[83]
AMP (Cecropin P1)Antibody and biotin label AMPColorimetric105-106 CFU/mLE. coli O157:H7, O26 and O111[84]

AMP : antimicrobial peptide; SPR : surface plasmon resonance; DIP : digital photocorrosion

4. CONCLUSION

Go to

항생제 남용으로 인한 박테리아의 내성이 증가하는 상황에서 병원성 박테리아의 감염은 현대 의학에서 심각한 위협을 초래한다. 항생제 대체 물질로써의 항균 펩타이드 연구는 오늘날까지도 많이 연구되고 있으며, 박테리아와 정전기적으로 상호작용한다는 점에서 박테리아를 검출할 수 있음을 시사한다. 박테리아 검출 방법 중 하나인 바이오센서는 보다 빠르고 신속하게 사용하다는 점에서 많은 관심을 받고 있으며, 생체 인식 요소로써의 항균 펩타이드 사용은 저렴한 비용, 높은 안정성, 합성의 편리함으로 인해 다른 생체 인식 요소보다 우수하다고 보고되고 있다 [11]. 또한, 항균 펩타이드 기반 바이오센서는 살아있는 박테리아와 죽어있는 박테리아를 선별할 수 있고, 실제 샘플에서 박테리아를 검출할 수 있는 수준까지 연구가 진행되고 있다. 하지만 이를 이용한 검출, 진단 바이오센서는 감도 및 특이성이 낮다는 이유로 아직 상업적으로 상용화되지 않고 있다. 이러한 단점은 항균 펩타이드의 엔지니어링 [60], 우수한 특성을 가진 나노 물질사용을 통해 해결할 수 있으며 [61], 이에 대한 추가적인 연구를 진행한다면 식품 산업에 있어 항균 펩타이드 기반 바이오센서는 상업적으로 상용화될 가능성이 높을 것으로 기대된다.

References

Go to
  1. Thakur, A. Sharma, H. K. Alajangi, P. K. Jaiswal, Y.-b. Lim, G. Singh and R. P. Barnwal (2022) In pursuit of next-generation therapeutics: Antimicrobial peptides against superbugs, their sources, mechanism of action, nanotechnology-based delivery, and clinical applications. Int. J. Biol. Macromol. 218: 135-156.
    Pubmed CrossRef
  2. C. A. Andrade, J. M. Nascimento, I. S. Oliveira, C. V. de Oliveira, C. P. de Melo, O. L. Franco and M. D. Oliveira (2015) Nanostructured sensor based on carbon nanotubes and clavanin A for bacterial detection. Colloids Surf. B 135: 833-839.
    Pubmed CrossRef
  3. M. A. Islam, W. M. Hassen, A. F. Tayabali and J. J. Dubowski (2020) Antimicrobial warnericin RK peptide functionalized GaAs/AlGaAs biosensor for highly sensitive and selective detection of Legionella pneumophila. Biochem. Eng. J. 154: 107435.
    CrossRef
  4. M. Hoyos-Nogués, F. Gil and C. Mas-Moruno (2018) Antimicrobial peptides: powerful biorecognition elements to detect bacteria in biosensing technologies. Molecules. 23: 1683.
    Pubmed KoreaMed CrossRef
  5. X. Liu, M. Marrakchi, D. Xu, H. Dong and S. Andreescu (2016) Biosensors based on modularly designed synthetic peptides for recognition, detection and live/dead differentiation of pathogenic bacteria. Biosens. Bioelectron 80: 9-16.
    Pubmed CrossRef
  6. S. Kumar, K. Balakrishna and H. Batra (2008) Enrichment-ELISA for detection of Salmonella typhi from food and water samples. Biomed. Environ. Sci. 21: 137-143.
    CrossRef
  7. M. Myint, Y. Johnson, N. Tablante and R. Heckert (2006) The effect of pre-enrichment protocol on the sensitivity and specificity of PCR for detection of naturally contaminated Salmonella in raw poultry compared to conventional culture. Food Microbiol. 23: 599-604.
    Pubmed CrossRef
  8. E. de Boer and R. R. Beumer (1999) Methodology for detection and typing of foodborne microorganisms. Int. J. Food Microbiol. 50: 119-130.
    CrossRef
  9. R. L. Caygill, G. E. Blair and P. A. Millner (2010) A review on viral biosensors to detect human pathogens. Anal. Chim. Acta 681: 8-15.
    Pubmed CrossRef
  10. P. Pashazadeh, A. Mokhtarzadeh, M. Hasanzadeh, M. Hejazi, M. Hashemi and M. de la Guardia (2017) Nano-materials for use in sensing of salmonella infections: recent advances. Biosens. Bioelectron. 87: 1050-1064.
    Pubmed CrossRef
  11. H. Etayash, L. Norman, T. Thundat and K. Kaur (2013) Peptidebacteria interactions using engineered surface-immobilized peptides from class IIa bacteriocins. Langmuir. 29: 4048-4056.
    Pubmed CrossRef
  12. M. S. Mannoor, S. Zhang, A. J. Link and M. C. McAlpine (2010) Electrical detection of pathogenic bacteria via immobilized antimicrobial peptides. Proc. Natl. Acad. Sci. U. S. A. 107: 19207-19212.
    Pubmed KoreaMed CrossRef
  13. R. J. Dubos (1939) Studies on a bactericidal agent extracted from a soil bacillus: I. Preparation of the agent. Its activity in vitro. Exp. Med. 70: 1.
    Pubmed KoreaMed CrossRef
  14. R. D. Hotchkiss and R. J. Dubos (1940) Fractionation of the bactericidal agent from cultures of a soil Bacillus. J. Biol. Chem. 132: 791-792.
    CrossRef
  15. M. Amiche and C. Galanth (2011) Dermaseptins as models for the elucidation of membrane-acting helical amphipathic antimicrobial peptides. Curr. Pharm. Biotechnol. 12: 1184-1193.
    Pubmed CrossRef
  16. R. E. Hancock and D. S. Chapple (1999) Peptide antibiotics. Antimicrob. Agents Chemother. 43: 1317-1323.
    Pubmed KoreaMed CrossRef
  17. Z. Lai, X. Yuan, H. Chen, Y. Zhu, N. Dong and A. Shan (2022) Strategies employed in the design of antimicrobial peptides with enhanced proteolytic stability. Biotechnol. Adv. 59: 107962.
    Pubmed CrossRef
  18. A. M. Lima, M. I. Azevedo, L. M. Sousa, N. S. Oliveira, C. R. Andrade, C. D. Freitas and P. F. Souza (2022) Plant antimicrobial peptides: An overview about classification, toxicity and clinical applications. Int. J. Biol. Macromol. 214 : 10-21.
    Pubmed CrossRef
  19. X. Luo, Y. Song, Z. Cao, Z. Qin, W. Dessie, N. He, Z. Wang and Y. Tan (2022) Evaluation of the antimicrobial activities and mechanisms of synthetic antimicrobial peptide against food-borne pathogens. Food Biosci. 49: 101903.
    CrossRef
  20. A. M. Carmona-Ribeiro and L. D. d. M. Carrasco (2014) Novel formulations for antimicrobial peptides. Int. J. Mol. Sci. 15: 18040-18083.
    Pubmed KoreaMed CrossRef
  21. K. A. Brogden (2005) Antimicrobial peptides: pore formers or metabolic inhibitors in bacteria? Nat. Rev. Microbiol. 3: 238-250.
    Pubmed CrossRef
  22. Y. Liu, D. E. Sameen, S. Ahmed, J. Dai and W. Qin (2021) Antimicrobial peptides and their application in food packaging. Trends Food Sci. Technol. 112: 471-483.
    CrossRef
  23. P. D. Cotter, C. Hill and R. P. Ross (2005) Bacteriocins: developing innate immunity for food. Nat. Rev. Microbiol. 3: 777-788.
    Pubmed CrossRef
  24. J. A. McIntosh, M. S. Donia and E. W. Schmidt (2009) Ribosomal peptide natural products: bridging the ribosomal and nonribosomal worlds. Nat. Prod. Rep. 26: 537-559.
    Pubmed KoreaMed CrossRef
  25. P. D. Cotter, R. P. Ross and C. Hill (2013) Bacteriocins—a viable alternative to antibiotics? Nat. Rev. Microbiol. 11: 95-105.
    Pubmed CrossRef
  26. P. G. Arnison, M. J. Bibb, G. Bierbaum, A. A. Bowers, T. S. Bugni, G. Bulaj, J. A. Camarero, D. J. Campopiano, G. L. Challis and J. Clardy (2013) Ribosomally synthesized and post-translationally modified peptide natural products: overview and recommendations for a universal nomenclature. Nat. Prod. Rep. 30: 108-160.
    Pubmed KoreaMed CrossRef
  27. T. Yi, S. Sun, Y. Huang and Y. Chen (2015) Prokaryotic expression and mechanism of action of α-helical antimicrobial peptide A20L using fusion tags. BMC Biotechnol. 15: 1-10.
    Pubmed KoreaMed CrossRef
  28. S. Deo, K. L. Turton, T. Kainth, A. Kumar and H.-J. Wieden (2022) Strategies for improving antimicrobial peptide production. Biotechnol. Adv. 59: 107968.
    Pubmed CrossRef
  29. J. Li, S. Hu, W. Jian, C. Xie and X. Yang (2021) Plant antimicrobial peptides: structures, functions, and applications. Bot. Stud. 62: 1-15.
    Pubmed KoreaMed CrossRef
  30. R. F. De Caleya, B. Gonzalez-Pascual, F. García-Olmedo and P. Carbonero (1972) Susceptibility of phytopathogenic bacteria to wheat purothionins in vitro. Appl. Microbiol. 23: 998-1000.
    Pubmed KoreaMed CrossRef
  31. F. Harris, A. Daman, J. Wallace, S. R. Dennison and D. A. Phoenix (2006) Oblique orientated α-helices and their prediction. Curr. Protein Pept. Sci 7: 529-537.
    Pubmed CrossRef
  32. Т. О, М. С and Е. H (2018) Plant thionins: structure, biological functions and potential use in biotechnology. Vavilovskii Zhurnal Genet. I Sel. 22: 667-675.
    CrossRef
  33. M. Hayes and S. Bleakley (2018) Peptides from plants and their applications. Biomaterials. 603-622.
    CrossRef
  34. S. Azmi and M. K. Hussain (2021) Analysis of structures, functions, and transgenicity of phytopeptides defensin and thionin: a review. Beni-Suef univ. j. basic appl. sci. 10: 1-11.
    CrossRef
  35. R. Sher Khan, A. Iqbal, R. Malak, K. Shehryar, S. Attia, T. Ahmed, M. Ali Khan, M. Arif and M. Mii (2019) Plant defensins: types, mechanism of action and prospects of genetic engineering for enhanced disease resistance in plants. 3 Biotech. 9: 1-12.
    Pubmed KoreaMed CrossRef
  36. A. d. De Lucca, T. Cleveland and D. Wedge (2005) Plant-derived antifungal proteins and peptides. Can. J. Microbiol. 51: 1001-1014.
    Pubmed CrossRef
  37. P. Bulet, C. Hetru, J.-L. Dimarcq and D. Hoffmann (1999) Antimicrobial peptides in insects; structure and function. Dev. Comp. Immunol. 23: 329-344.
    CrossRef
  38. Y. Li, Q. Xiang, Q. Zhang, Y. Huang and Z. Su (2012) Overview on the recent study of antimicrobial peptides: origins, functions, relative mechanisms and application. Peptides. 37: 207-215.
    Pubmed CrossRef
  39. M. Tonk, A. Vilcinskas and M. Rahnamaeian (2016) Insect antimicrobial peptides: potential tools for the prevention of skin cancer. Appl. Microbiol. Biotechnol. 100: 7397-7405.
    Pubmed KoreaMed CrossRef
  40. D. Hultmark, H. STEINER, T. RASMUSON and H. G. BOMAN (1980) Insect immunity. Purification and properties of three inducible bactericidal proteins from hemolymph of immunized pupae of Hyalophora cecropia. FEBS J. 106: 7-16.
    Pubmed CrossRef
  41. D. Brady, A. Grapputo, O. Romoli and F. Sandrelli (2019) Insect cecropins, antimicrobial peptides with potential therapeutic applications. Int. J. Mol. Sci. 20: 5862.
    Pubmed KoreaMed CrossRef
  42. D. Duwadi, A. Shrestha, B. Yilma, I. Kozlovski, M. Sa-Eed, N. Dahal and J. Jukosky (2018) Identification and screening of potent antimicrobial peptides in arthropod genomes. Peptides. 103: 26-30.
    Pubmed KoreaMed CrossRef
  43. P. Casteels, C. Ampe, F. Jacobs, M. Vaeck and P. Tempst (1989) Apidaecins: antibacterial peptides from honeybees. EMBO Rep. 8: 2387-2391.
    Pubmed KoreaMed CrossRef
  44. D. Hultmark, A. Engström, K. Andersson, H. Steiner, H. Bennich and H. Boman (1983) Insect immunity. Attacins, a family of antibacterial proteins from Hyalophora cecropia. EMBO Rep. 2: 571-576.
    Pubmed KoreaMed CrossRef
  45. I. Eleftherianos, W. Zhang, C. Heryanto, A. Mohamed, G. Contreras, G. Tettamanti, M. Wink and T. Bassal (2021) Diversity of insect antimicrobial peptides and proteins-A functional perspective: A review. Int. J. Biol. Macromol. 191: 277-287.
    Pubmed CrossRef
  46. J. C. Santos, R. C. Sousa, C. G. Otoni, A. R. Moraes, V. G. Souza, E. A. Medeiros, P. J. Espitia, A. C. Pires, J. S. Coimbra and N. F. Soares (2018) Nisin and other antimicrobial peptides: Production, mechanisms of action, and application in active food packaging. Innov. Food Sci. Emerg. Technol. 48: 179-194.
    CrossRef
  47. L. L. Ling, T. Schneider, A. J. Peoples, A. L. Spoering, I. Engels, B. P. Conlon, A. Mueller, T. F. Schäberle, D. E. Hughes and S. Epstein (2015) A new antibiotic kills pathogens without detectable resistance. Nature. 517: 455-459.
    Pubmed KoreaMed CrossRef
  48. M. A. Arugula and A. Simonian (2014) Novel trends in affinity biosensors: current challenges and perspectives. Meas. Sci. Technol. 25: 032001.
    CrossRef
  49. H. Etayash, L. Norman, T. Thundat, M. Stiles and K. Kaur (2014) Surface-conjugated antimicrobial peptide leucocin a displays high binding to pathogenic gram-positive bacteria. ACS Appl. Mater. Interfaces. 6: 1131-1138.
    Pubmed CrossRef
  50. M. Zasloff (2002) Antimicrobial peptides of multicellular organisms. Nature. 415: 389-395.
    Pubmed CrossRef
  51. Z. Qiao, Y. Fu, C. Lei and Y. Li (2020) Advances in antimicrobial peptides-based biosensing methods for detection of foodborne pathogens: A review. Food Control. 112: 107116.
    CrossRef
  52. A. G. da Silva Junior, I. A. Frias, R. G. Lima-Neto, O. L. Franco, M. D. Oliveira and C. A. Andrade (2022) Electrochemical detection of gram-negative bacteria through mastoparan-capped magnetic nanoparticle. Enzyme Microb. Technol. 160: 110088.
    Pubmed CrossRef
  53. Y. Zhou, Y. Fang and R. P. Ramasamy (2019) Non-covalent functionalization of carbon nanotubes for electrochemical biosensor development. Sens. 19: 392.
    Pubmed KoreaMed CrossRef
  54. I. H. Lee, Y. Cho and R. I. Lehrer (1997) Effects of pH and salinity on the antimicrobial properties of clavanins. Infect. Immun. 65: 2898-2903.
    Pubmed KoreaMed CrossRef
  55. Y. Li, R. Afrasiabi, F. Fathi, N. Wang, C. Xiang, R. Love, Z. She and H.-B. Kraatz (2014) Impedance based detection of pathogenic E. coli O157: H7 using a ferrocene-antimicrobial peptide modified biosensor. Biosens. Bioelectron 58: 193-199.
    Pubmed CrossRef
  56. C. Zhou, H. Zou, M. Li, C. Sun, D. Ren and Y. Li (2018) Fiber optic surface plasmon resonance sensor for detection of E. coli O157: H7 based on antimicrobial peptides and AgNPs-rGO. Biosens. Bioelectron 117: 347-353.
    Pubmed CrossRef
  57. M. Rubab, H. M. Shahbaz, A. N. Olaimat and D.-H. Oh (2018) Biosensors for rapid and sensitive detection of Staphylococcus aureus in food. Biosens. Bioelectron 105: 49-57.
    Pubmed CrossRef
  58. A. Philip and A. R. Kumar (2022) The performance enhancement of surface plasmon resonance optical sensors using nanomaterials: A review. Coord. Chem. Rev. 458: 214424.
    CrossRef
  59. J. H. Yoo, D. H. Woo, M.-S. Chang and M.-S. Chun (2014) Microfluidic based biosensing for Escherichia coli detection by embedding antimicrobial peptide-labeled beads. Sens. Actuators B Chem. 191: 211-218.
    CrossRef
  60. M. Lv, Y. Liu, J. Geng, X. Kou, Z. Xin and D. Yang (2018) Engineering nanomaterials-based biosensors for food safety detection. Biosens. Bioelectron 106: 122-128.
    Pubmed CrossRef
  61. A. G. da Silva-Junio, I. A. Frias, R. G. Lima-Neto, L. Migliolo, P. S. e Silva, M. D. Oliveira and C. A. Andrade (2022) Electrochemical biosensor based on Temporin-PTA peptide for detection of microorganisms. J. Pharm. Biomed. Anal 216: 114788.
    Pubmed CrossRef
  62. I. Bazin, S. A. Tria, A. Hayat and J.-L. Marty (2017) New biorecognition molecules in biosensors for the detection of toxins. Biosens. Bioelectron 87: 285-298.
    Pubmed CrossRef
  63. W. Liu, H. Song, Q. Chen, J. Yu, M. Xian, R. Nian and D. Feng (2018) Recent advances in the selection and identification of antigen-specific nanobodies. Mol. Immunol. 96: 37-47.
    Pubmed CrossRef
  64. M. Majdinasab, M. Daneshi and J. L. Marty (2021) Recent developments in non-enzymatic (bio) sensors for detection of pesticide residues: Focusing on antibody, aptamer and molecularly imprinted polymer. Talanta. 232: 122397.
    Pubmed CrossRef
  65. J. d. D. Habimana, J. Ji and X. Sun (2018) Minireview: trends in optical-based biosensors for point-of-care bacterial pathogen detection for food safety and clinical diagnostics. Anal. Lett. 51: 2933-2966.
    CrossRef
  66. L. E. Townsley, W. A. Tucker, S. Sham and J. F. Hinton (2001) Structures of gramicidins A, B, and C incorporated into sodium dodecyl sulfate micelles. Biochemistry. 40: 11676-11686.
    Pubmed CrossRef
  67. F. S. Tareq, M. A. Lee, H.-S. Lee, Y.-J. Lee, J. S. Lee, C. M. Hasan, M. T. Islam and H. J. Shin (2014) Gageotetrins A-C, noncytotoxic antimicrobial linear lipopeptides from a marine bacterium Bacillus subtilis. Org. Lett. 16: 928-931.
    Pubmed CrossRef
  68. R. Salomon and R. N. Farías (1992) Microcin 25, a novel antimicrobial peptide produced by Escherichia coli. J. Bacteriol. 174: 7428-7435.
    Pubmed KoreaMed CrossRef
  69. M. Novikova, A. Metlitskaya, K. Datsenko, T. Kazakov, A. Kazakov, B. Wanner and K. Severinov (2007) The Escherichia coli Yej transporter is required for the uptake of translation inhibitor microcin C. J. Bacteriol. 189: 8361-8365.
    Pubmed KoreaMed CrossRef
  70. H. S. Rollema, O. P. Kuipers, P. Both, W. M. De Vos and R. J. Siezen (1995) Improvement of solubility and stability of the antimicrobial peptide nisin by protein engineering. Appl. Environ. Microbiol. 61: 2873-2878.
    Pubmed KoreaMed CrossRef
  71. J. P. Tam, Y.-A. Lu, J.-L. Yang and K.-W. Chiu (1999) An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides. PNAS. 96: 8913-8918.
    Pubmed KoreaMed CrossRef
  72. R. W. Osborn, G. W. De Samblanx, K. Thevissen, I. Goderis, S. Torrekens, F. Van Leuven, S. Attenborough, S. B. Rees and W. F. Broekaert (1995) Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae. FEBS Lett. 368: 257-262.
    CrossRef
  73. P. Fehlbaum, P. Bulet, S. Chernysh, J.-P. Briand, J.-P. Roussel, L. Letellier, C. Hetru and J. A. Hoffmann (1996) Structure-activity analysis of thanatin, a 21-residue inducible insect defense peptide with sequence homology to frog skin antimicrobial peptides. PNAS. 93: 1221-1225.
    Pubmed KoreaMed CrossRef
  74. Q. Wu, J. Patočka and K. Kuča (2018) Insect antimicrobial peptides, a mini review. Toxins. 10: 461.
    Pubmed KoreaMed CrossRef
  75. X.-X. Xu, X. Zhong, H.-Y. Yi and X.-Q. Yu (2012) Manduca sexta gloverin binds microbial components and is active against bacteria and fungi. Dev. Comp. Immunol. 38: 275-284.
    Pubmed KoreaMed CrossRef
  76. J. L. de Miranda, M. D. Oliveira, I. S. Oliveira, I. A. Frias, O. L. Franco and C. A. Andrade (2017) A simple nanostructured biosensor based on clavanin A antimicrobial peptide for gram-negative bacteria detection. Biochem. Eng. J. 124: 108-114.
    CrossRef
  77. M. Hoyos-Nogués, S. Brosel-Oliu, N. Abramova, F.-X. Muñoz, A. Bratov, C. Mas-Moruno and F.-J. Gil (2016) Impedimetric antimicrobial peptide-based sensor for the early detection of periodontopathogenic bacteria. Biosens. Bioelectron 86: 377-385.
    Pubmed CrossRef
  78. F. Malvano, R. Pilloton and D. Albanese (2020) A novel impedimetric biosensor based on the antimicrobial activity of the peptide nisin for the detection of Salmonella spp. Food Chem. 325: 126868.
    Pubmed CrossRef
  79. H. Etayash, K. Jiang, T. Thundat and K. Kaur (2014) Impedimetric detection of pathogenic gram-positive bacteria using an antimicrobial peptide from class IIa bacteriocins. Anal. Chem. 86: 1693-1700.
    Pubmed CrossRef
  80. P. B. Lillehoj, C. W. Kaplan, J. He, W. Shi and C.-M. Ho (2014) Rapid, electrical impedance detection of bacterial pathogens using immobilized antimicrobial peptides. J. Lab. Autom. 19: 42-49.
    Pubmed CrossRef
  81. N. V. Kulagina, M. E. Lassman, F. S. Ligler and C. R. Taitt (2005) Antimicrobial peptides for detection of bacteria in biosensor assays. Anal. Chem. 77: 6504-6508.
    Pubmed CrossRef
  82. S. Arcidiacono, P. Pivarnik, C. M. Mello and A. Senecal (2008) Cy5 labeled antimicrobial peptides for enhanced detection of Escherichia coli O157: H7. Biosens. Bioelectron 23: 1721-1727.
    Pubmed CrossRef
  83. Z. Qiao, C. Lei, Y. Fu and Y. Li (2017) An antimicrobial peptidebased colorimetric bioassay for rapid and sensitive detection of E. coli O157: H7. RSC Adv. 7: 15769-15775.
    CrossRef
  84. T. Yonekita, R. Ohtsuki, E. Hojo, N. Morishita, T. Matsumoto, T. Aizawa and F. Morimatsu (2013) Development of a novel multiplex lateral flow assay using an antimicrobial peptide for the detection of Shiga toxin-producing Escherichia coli. J. Microbiol. Methods 93: 251-256.
    Pubmed CrossRef

Stats or Metrics

Share this article on :

Related articles in KSBB

more +

© 2021. Korean Society for Biotechnology and Bioengineering All Rights Reserved.